Antibodies

Jump to Filters
View as table Download
GJB4 Rabbit Polyclonal Antibody
TA341676

USD 310.00

5 Days

Rabbit Polyclonal Anti-GJB4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GJB4 antibody: synthetic peptide directed towards the middle region of human GJB4. Synthetic peptide located within the following region: CPSLLVVMHVAYREERERKHHLKHGPNAPSLYDNLSKKRGGLWWTYLLSL
GJB4 Rabbit Polyclonal Antibody
TA350757

USD 345.00

In Stock

Rabbit Polyclonal Anti-GJB4 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human GJB4
GJB4 Rabbit Polyclonal Antibody
TA366842

USD 380.00

4 Weeks

GJB4 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human GJB4
GJB4 Rabbit Polyclonal Antibody
TA376580

USD 220.00

3 Weeks

GJB4 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human GJB4 (NP_694944.1).
Modifications Unmodified