Antibodies

Jump to Filters
View as table Download
Galactosidase alpha (GLA) (N-term) Rabbit Polyclonal Antibody
AP17424PU-N

USD 450.00

2 Weeks

Galactosidase alpha (GLA) (N-term) rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 90~120 amino acids from the N-terminal region of human GLA
Galactosidase alpha (GLA) Rabbit Polyclonal Antibody
TA336243

USD 375.00

5 Days

Rabbit Polyclonal Anti-GLA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GLA Antibody: synthetic peptide directed towards the N terminal of human GLA. Synthetic peptide located within the following region: PQRFPHGIRQLANYVHSKGLKLGIYADVGNKTCAGFPGSFGYYDIDAQTF
Galactosidase alpha (GLA) Rabbit Polyclonal Antibody
TA376586

USD 220.00

3 Weeks

Galactosidase alpha (GLA) Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 150-429 of human Galactosidase alpha (Galactosidase alpha (GLA)) (NP_000160.1).
Modifications Unmodified
Galactosidase alpha (GLA) Rabbit Polyclonal Antibody
TA376587

USD 220.00

3 Weeks

Galactosidase alpha (GLA) Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 150-429 of human Galactosidase alpha (Galactosidase alpha (GLA)) (NP_000160.1).
Modifications Unmodified