Rabbit anti-GLUL Polyclonal Antibody
| Applications | ELISA, ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti-GLUL Polyclonal Antibody
| Applications | ELISA, ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Glutamine Synthetase (GLUL) rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Conjugation | Unconjugated |
Anti-GLUL Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around aa.365~369(G-D-E-P-F) derived from Human Glutamine Synthetase |
Glutamine Synthetase (GLUL) (N-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human GLUL |
Rabbit Polyclonal Antibody against Glutamine Synthase
| Applications | WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein. |
Rabbit Polyclonal Anti-GLUL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GLUL antibody: synthetic peptide directed towards the C terminal of human GLUL. Synthetic peptide located within the following region: TGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFS |
Carrier-free (BSA/glycerol-free) GLUL mouse monoclonal antibody, clone OTI1F4 (formerly 1F4)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 545.00
3 Days
Carrier-free (BSA/glycerol-free) GS mouse monoclonal antibody, clone OTI2C12
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-GLUL Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human GLUL |
GLUL Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human GLUL |
GLUL Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle terminal region of human GLUL |
GLUL rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human GLUL |
USD 447.00
In Stock
GLUL mouse monoclonal antibody, clone OTI1F4 (formerly 1F4)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 509.00
In Stock
GLUL mouse monoclonal antibody, clone OTI1F4 (formerly 1F4), Biotinylated
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 509.00
2 Weeks
GLUL mouse monoclonal antibody, clone OTI1F4 (formerly 1F4), HRP conjugated
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
USD 200.00
In Stock
GLUL mouse monoclonal antibody, clone OTI1F4 (formerly 1F4)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 447.00
In Stock
GS mouse monoclonal antibody, clone OTI2C12
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 420.00
2 Weeks
GS mouse monoclonal antibody, clone OTI2C12, Biotinylated
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
2 Weeks
GS mouse monoclonal antibody, clone OTI2C12, HRP conjugated
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
USD 159.00
2 Weeks
GS mouse monoclonal antibody, clone OTI2C12
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |