Antibodies

Jump to Filters
View as table Download
Giantin (GOLGB1) Rabbit Polyclonal Antibody
TA339419

USD 375.00

5 Days

Rabbit Polyclonal Anti-GOLGB1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GOLGB1 antibody: synthetic peptide directed towards the N terminal of human GOLGB1. Synthetic peptide located within the following region: NKYIEEMKAQGGTVLPTEPQSEEQLSKHDKSSTEEEMEIEKIKHKLQEKE
Giantin (GOLGB1) Rabbit Polyclonal Antibody
TA376677

USD 220.00

3 Weeks

GOLGB1 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human GOLGB1.
Modifications Unmodified