Giantin (GOLGB1) Rabbit Polyclonal Antibody

CAT#: TA339419

Rabbit Polyclonal Anti-GOLGB1 Antibody

Product Images

WB Suggested Anti-GOLGB1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 12500; Positive Control: 721_B cell lysate.GOLGB1 is supported by BioGPS gene expression data to be expressed in 721_B

• 

  Uterus

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GOLGB1 antibody: synthetic peptide directed towards the N terminal of human GOLGB1. Synthetic peptide located within the following region: NKYIEEMKAQGGTVLPTEPQSEEQLSKHDKSSTEEEMEIEKIKHKLQEKE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 376 kDa
• Gene Name: golgin B1
• Database Link:
  NP_004478
  Entrez Gene 2804 Human
  UniProt ID Q14789
• Background: May participate in forming intercisternal cross-bridges of the Golgi complex.
• Synonyms: GCP; GCP372; GOLIM1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Horse: 93%; Rat: 92%; Mouse: 85%

Reference Data

• Protein Families: Transcription Factors, Transmembrane