Antibodies

Jump to Filters
View as table Download
GPR141 Rabbit Polyclonal Antibody
TA331550

USD 375.00

5 Days

Rabbit Polyclonal Anti-GPR141 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GPR141 Antibody is: synthetic peptide directed towards the middle region of Human GPR141. Synthetic peptide located within the following region: DKVEFYRKLHAVAASAGMWTLVIVIVVPLVVSRYGIHEEYNEEHCFKFHK
GPR141 Rabbit Polyclonal Antibody
TA376724

USD 220.00

3 Weeks

GPR141 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human GPR141 (NP_001316922.1).
Modifications Unmodified