GPR141 Rabbit Polyclonal Antibody

CAT#: TA331550

Rabbit Polyclonal Anti-GPR141 Antibody

Product Images

Host: Rabbit; Target Name: GPR141; Sample Tissue: 721_B Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-GPR141 Antibody is: synthetic peptide directed towards the middle region of Human GPR141. Synthetic peptide located within the following region: DKVEFYRKLHAVAASAGMWTLVIVIVVPLVVSRYGIHEEYNEEHCFKFHK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: G protein-coupled receptor 141
• Database Link:
  NP_861456
  Entrez Gene 353345 Human
  UniProt ID Q7Z602
• Background: GPR141 is a member of the rhodopsin family of G protein-coupled receptors (GPRs).
• Synonyms: PGR13
• Note: Immunogen sequence homology: Human: 100%; Rabbit: 89%

Reference Data

• Protein Families: Druggable Genome, Transmembrane