GPR162 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GPR162 |
GPR162 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GPR162 |
Rabbit Polyclonal Anti-GPR162 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GPR162 Antibody is: synthetic peptide directed towards the N-terminal region of Human GPR162. Synthetic peptide located within the following region: ILSISAKQQKHKPLELLLCFLAGTHILMAAVPLTTFAVVQLRRQASSDYD |
Rabbit Polyclonal Anti-GPR162 Antibody (Transmembrane Domain)
Applications | IHC |
Reactivities | Human |
Immunogen | GPR162 antibody was raised against synthetic 19 amino acid peptide from 6th transmembrane domain of human GPR162. Percent identity with other species by BLAST analysis: Human, Monkey (100%); Gibbon, Rat, Dog, Pig (95%); Mouse, Bovine, Hamster, Panda, Horse (89%); Bat, Elephant (84%). |
GPR162 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GPR162 |