Antibodies

View as table Download

GPRC6A rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human GPRC6A

Rabbit polyclonal antibody to GPRC6A (G protein-coupled receptor, family C, group 6, member A)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 862 and 926 of GPRC6A (Uniprot ID#Q5T6X5)

GPRC6A Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Gorilla, Human, Monkey
Conjugation Unconjugated
Immunogen GPRC6A antibody was raised against synthetic 17 amino acid peptide from N-terminal extracellular domain of human GPRC6A. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Panda (100%); Dog, Elephant, Rabbit, Horse, Pig (94%); Marmoset, Mouse, Rat, Bovine, Hamster (82%).

Rabbit Polyclonal Anti-GPRC6A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPRC6A antibody is: synthetic peptide directed towards the N-terminal region of Human GPRC6A. Synthetic peptide located within the following region: SQPCQTPDDFVAATSPGHIIIGGLFAIHEKMLSSEDSPRRPQIQECVGFE

Rabbit polyclonal anti-GPC6A antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GPC6A.

Rabbit Polyclonal Anti-GPRC6A Antibody (N-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen GPRC6A antibody was raised against synthetic 18 amino acid peptide from N-terminal extracellular domain of human GPRC6A. Percent identity with other species by BLAST analysis: Human (100%), Gorilla (100%), Monkey (94%), Marmoset (89%), Mouse (89%), Rat (89%), Bat (89%), Elephant (89%), Hamster (83%), Panda (83%), Horse (83%), Pig (83%).

GPRC6A (N-term) rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated

GPRC6A Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Gorilla, Human
Conjugation Unconjugated
Immunogen GPRC6A antibody was raised against synthetic 14 amino acid peptide from N-terminal extracellular domain of human GPRC6A. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Rat, Hamster, Rabbit (93%); Monkey, Marmoset, Mouse, Dog, Elephant, Panda, Horse (86%).

GPRC6A Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated

GPRC6A rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human GPRC6A

GPRC6A Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 300-590 of human GPRC6A (NP_683766.2).
Modifications Unmodified