GPRC6A rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GPRC6A |
GPRC6A rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GPRC6A |
Rabbit polyclonal antibody to GPRC6A (G protein-coupled receptor, family C, group 6, member A)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 862 and 926 of GPRC6A (Uniprot ID#Q5T6X5) |
GPRC6A Rabbit Polyclonal (N-Terminus) Antibody
Applications | IHC |
Reactivities | Gorilla, Human, Monkey |
Conjugation | Unconjugated |
Immunogen | GPRC6A antibody was raised against synthetic 17 amino acid peptide from N-terminal extracellular domain of human GPRC6A. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Panda (100%); Dog, Elephant, Rabbit, Horse, Pig (94%); Marmoset, Mouse, Rat, Bovine, Hamster (82%). |
Rabbit Polyclonal Anti-GPRC6A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GPRC6A antibody is: synthetic peptide directed towards the N-terminal region of Human GPRC6A. Synthetic peptide located within the following region: SQPCQTPDDFVAATSPGHIIIGGLFAIHEKMLSSEDSPRRPQIQECVGFE |
Rabbit polyclonal anti-GPC6A antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GPC6A. |
Rabbit Polyclonal Anti-GPRC6A Antibody (N-Terminus)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | GPRC6A antibody was raised against synthetic 18 amino acid peptide from N-terminal extracellular domain of human GPRC6A. Percent identity with other species by BLAST analysis: Human (100%), Gorilla (100%), Monkey (94%), Marmoset (89%), Mouse (89%), Rat (89%), Bat (89%), Elephant (89%), Hamster (83%), Panda (83%), Horse (83%), Pig (83%). |
GPRC6A (N-term) rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
GPRC6A Rabbit Polyclonal (N-Terminus) Antibody
Applications | IHC |
Reactivities | Gorilla, Human |
Conjugation | Unconjugated |
Immunogen | GPRC6A antibody was raised against synthetic 14 amino acid peptide from N-terminal extracellular domain of human GPRC6A. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Rat, Hamster, Rabbit (93%); Monkey, Marmoset, Mouse, Dog, Elephant, Panda, Horse (86%). |
GPRC6A Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
GPRC6A rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GPRC6A |
GPRC6A Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 300-590 of human GPRC6A (NP_683766.2). |
Modifications | Unmodified |