GPRC6A Rabbit Polyclonal Antibody

CAT#: TA337887

Rabbit Polyclonal Anti-GPRC6A Antibody

Product Images

WB Suggested Anti-GPRC6A Antibody; Titration: 1.0 ug/ml; Positive Control: 293T Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GPRC6A antibody is: synthetic peptide directed towards the N-terminal region of Human GPRC6A. Synthetic peptide located within the following region: SQPCQTPDDFVAATSPGHIIIGGLFAIHEKMLSSEDSPRRPQIQECVGFE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 103 kDa
• Gene Name: G protein-coupled receptor class C group 6 member A
• Database Link:
  NP_683766
  Entrez Gene 222545 Human
  UniProt ID Q5T6X5
• Background: Members of family C of the G protein-coupled receptor (GPCR) superfamily, such as GPRC6A, are characterized by an evolutionarily conserved amino acid-sensing motif linked to an intramembranous 7-transmembrane loop region. Several members of GPCR family C, including GPRC6A, also have a long N-terminal domain.
• Synonyms: bA86F4.3; GPCR
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 79%; Mouse: 79%; Rabbit: 79%; Dog: 77%; Rat: 77%

Reference Data

• Protein Families: Druggable Genome, Transmembrane