GULP1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human GULP1 |
GULP1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human GULP1 |
Goat Polyclonal Antibody against GULP1
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence EGTVFCLDPLDSRC, from the C Terminus of the protein sequence according to NP_057399.1. |
Rabbit polyclonal antibody to GULP1 (GULP, engulfment adaptor PTB domain containing 1)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 241 and 304 of GULP1 (Uniprot ID#Q9UBP9) |
Rabbit Polyclonal Anti-GULP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GULP1 antibody is: synthetic peptide directed towards the N-terminal region of Human GULP1. Synthetic peptide located within the following region: AKFLGSTEVEQPKGTEVVRDAVRKLKFARHIKKSEGQKIPKVELQISIYG |
GULP1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human GULP1 |
GULP1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human GULP1 |
GULP1 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human GULP1 (NP_057399.1). |
| Modifications | Unmodified |