Antibodies

Jump to Filters
View as table Download
HIST2H2BF Rabbit Polyclonal Antibody
TA336063

USD 375.00

5 Days

Rabbit Polyclonal Anti-HIST2H2BF Antibody

Applications Assay, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-HIST2H2BF Antibody: synthetic peptide directed towards the N terminal of human HIST2H2BF. Synthetic peptide located within the following region: MPDPAKSAPAPKKGSKKAVTKVQKKDGKKRKRSRKESYSVYVYKVLKQVH