Antibodies

View as table Download

Rabbit polyclonal anti-HA2Q antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human HA2Q.

Rabbit Polyclonal Anti-HLA-DPA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HLA-DPA1 antibody: synthetic peptide directed towards the middle region of human HLA-DPA1. Synthetic peptide located within the following region: EAQEPIQMPETTETVLCALGLVLGLVGIIVGTVLIIKSLRSGHDPRAQGT

HLA-DPA1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human HLA-DPA1

HLA-DPA1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 40-220 of human HLA-DPA1 (NP_291032.2).
Modifications Unmodified