HLA DP (HLA-DPA1) Rabbit Polyclonal Antibody

CAT#: TA342062

Rabbit Polyclonal Anti-HLA-DPA1 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "HLA-DPA1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-HLA-DPA1 antibody: synthetic peptide directed towards the middle region of human HLA-DPA1. Synthetic peptide located within the following region: EAQEPIQMPETTETVLCALGLVLGLVGIIVGTVLIIKSLRSGHDPRAQGT
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 26 kDa
Gene Name major histocompatibility complex, class II, DP alpha 1
Background The specific function ofThis protein remains unknown.HLA-DPA1 belongs toThe HLA class II alpha chain paralogues.This class II molecule is a heterodimer consisting of an alpha (DPA) and a beta (DPB) chain, both anchored inThe membrane. It plays a central role inThe immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages).The alpha chain is approximately 33-35 kDa and its gene contains 5 exons. Exon one encodesThe leader peptide, exons 2 and 3 encodeThe two extracellular domains, exon 4 encodesThe transmembrane domain andThe cytoplasmic tail. WithinThe DP molecule bothThe alpha chain andThe beta chain containThe polymorphisms specifyingThe peptide binding specificities, resulting in up to 4 different molecules. Publication Note:This RefSeq record includes a subset ofThe publications that are available forThis gene. Please seeThe Entrez Gene record to access additional publications.
Synonyms DP(W3); DP(W4); HLA-DP1A; HLADP; HLASB; PLT1
Note Immunogen Sequence Homology: Human: 100%; Pig: 86%
Reference Data
Protein Families Transmembrane
Protein Pathways Allograft rejection, Antigen processing and presentation, Asthma, Autoimmune thyroid disease, Cell adhesion molecules (CAMs), Graft-versus-host disease, Systemic lupus erythematosus, Type I diabetes mellitus, Viral myocarditis

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.