Antibodies

View as table Download

HLTF (Center) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the Center region of human HIP116A

Goat Polyclonal Antibody against SMARCA3

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KQAKINEIRTLIDL, from the C Terminus of the protein sequence according to NP_003062.2; NP_620636.1.

Rabbit Polyclonal Anti-SMARCA3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SMARCA3 Antibody: synthetic peptide directed towards the C terminal of human SMARCA3. Synthetic peptide located within the following region: FIVKDSVEENMLKIQNKKRELAAGAFGTKKPNADEMKQAKINEIRTLIDL

Rabbit Polyclonal Anti-SMARCA3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SMARCA3 Antibody: synthetic peptide directed towards the N terminal of human SMARCA3. Synthetic peptide located within the following region: DPVWKYLQTVQYGVHGNFPRLSYPTFFPRFEFQDVIPPDDFLTSDEEVDS

Rabbit Polyclonal Anti-HLTF Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-HLTF Antibody: synthetic peptide directed towards the N terminal of human HLTF. Synthetic peptide located within the following region: SWMFKRDPVWKYLQTVQYGVHGNFPRLSYPTFFPRFEFQDVIPPDDFLTS

Rabbit Polyclonal Anti-HLTF Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human HLTF

HLTF Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human HLTF

HLTF rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human HLTF

HLTF Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 726-1009 of human HLTF (NP_620636.1).
Modifications Unmodified

HLTF Rabbit monoclonal Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

Rabbit polyclonal anti-HLTF Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human HLTF

Rabbit polyclonal anti-HLTF Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human HLTF