Germany
Japan
United Kingdom
China
HLTF (Center) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the Center region of human HIP116A |
Antibodies
View as table Download
Goat Polyclonal Antibody against SMARCA3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KQAKINEIRTLIDL, from the C Terminus of the protein sequence according to NP_003062.2; NP_620636.1. |
Rabbit Polyclonal Anti-SMARCA3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SMARCA3 Antibody: synthetic peptide directed towards the C terminal of human SMARCA3. Synthetic peptide located within the following region: FIVKDSVEENMLKIQNKKRELAAGAFGTKKPNADEMKQAKINEIRTLIDL |
Rabbit Polyclonal Anti-SMARCA3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SMARCA3 Antibody: synthetic peptide directed towards the N terminal of human SMARCA3. Synthetic peptide located within the following region: DPVWKYLQTVQYGVHGNFPRLSYPTFFPRFEFQDVIPPDDFLTSDEEVDS |
Rabbit Polyclonal Anti-HLTF Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-HLTF Antibody: synthetic peptide directed towards the N terminal of human HLTF. Synthetic peptide located within the following region: SWMFKRDPVWKYLQTVQYGVHGNFPRLSYPTFFPRFEFQDVIPPDDFLTS |
HLTF Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human HLTF |
HLTF Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 726-1009 of human HLTF (NP_620636.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- HLTF