Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-HNRPA3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPA3 antibody: synthetic peptide directed towards the N terminal of human HNRPA3. Synthetic peptide located within the following region: MEVKPPPGRPQPDSGRRRRRRGEEGHDPKEPEQLRKLFIGGLSFETTDDS |
Rabbit Polyclonal Anti-HNRPA3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPA3 antibody: synthetic peptide directed towards the N terminal of human HNRPA3. Synthetic peptide located within the following region: PGRPQPDSGRRRRRRGEEGHDPKEPEQLRKLFIGGLSFETTDDSLREHFE |
HNRNPA3 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human ROA3 |
HNRNPA3 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human HNRNPA3 |
HNRNPA3 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic Peptide of human HNRNPA3 |
| Modifications | Unmodified |
Active filters
Target Symbol
- HNRNPA3