HNRPA3 (HNRNPA3) Rabbit Polyclonal Antibody

CAT#: TA344034

Rabbit Polyclonal Anti-HNRPA3 Antibody

Product Images

Host: Rabbit; Target Name: HNRPA3; Sample Tissue: Jurkat; Lane A: Primary Antibody; Lane B: Primary Antibody + Blocking Peptide; Primary Antibody Concentration: 0.625 ug/mL; Peptide Concentration: 1.0 ug/mL; Lysate Quantity: 25 ug/lane; Gel Concentration:

• 

  WB Suggested Anti-HNRPA3 Antibody Titration: 1.25 ug/ml; Positive Control: Jurkat cell lysate; HNRNPA3 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells

• 

  Rabbit Anti-HNRPA3 Antibody; Paraffin Embedded Tissue: Human Liver; Cellular Data: Hepatocytes; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HNRPA3 antibody: synthetic peptide directed towards the N terminal of human HNRPA3. Synthetic peptide located within the following region: MEVKPPPGRPQPDSGRRRRRRGEEGHDPKEPEQLRKLFIGGLSFETTDDS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 42 kDa
• Gene Name: heterogeneous nuclear ribonucleoprotein A3
• Database Link:
  NP_919223
  Entrez Gene 220988 Human
  UniProt ID P51991
• Background: HNRPA3 plays a role in cytoplasmic trafficking of RNA. It binds to the cis-acting response element(A2RE) and may be involved in pre-mRNA splicing
• Synonyms: 2610510D13Rik; D10S102; FBRNP; HNRPA3
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Pathways: Spliceosome