Antibodies

View as table Download

Rabbit Polyclonal Anti-HNRPUL1 Antibody

Applications IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HNRPUL1 antibody: synthetic peptide directed towards the C terminal of human HNRPUL1. Synthetic peptide located within the following region: TYPQPSYNQYQQYAQQWNQYYQNQGQWPPYYGNYDYGSYSGNTQGGTSTQ

HNRNPUL1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human HNRNPUL1

Rabbit Polyclonal Anti-HNRPUL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HNRPUL1 antibody: synthetic peptide directed towards the middle region of human HNRPUL1. Synthetic peptide located within the following region: LPDVGDFLDEVLFIELQREEADKLVRQYNEEGRKAGPPPEKRFDNRGGGG

Rabbit Polyclonal Anti-HNRNPUL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-HNRNPUL1 Antibody is: synthetic peptide directed towards the N-terminal region of Human HNRNPUL1. Synthetic peptide located within the following region: MGFCHVGQAGLELLTSGDPPASASQSAGITGVSHRARPSVFVFLIHYSSF

HNRNPUL1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human HNRNPUL1