Rabbit Polyclonal Anti-HNRPUL1 Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPUL1 antibody: synthetic peptide directed towards the C terminal of human HNRPUL1. Synthetic peptide located within the following region: TYPQPSYNQYQQYAQQWNQYYQNQGQWPPYYGNYDYGSYSGNTQGGTSTQ |
Rabbit Polyclonal Anti-HNRPUL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPUL1 antibody: synthetic peptide directed towards the middle region of human HNRPUL1. Synthetic peptide located within the following region: LPDVGDFLDEVLFIELQREEADKLVRQYNEEGRKAGPPPEKRFDNRGGGG |
Rabbit Polyclonal Anti-HNRNPUL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-HNRNPUL1 Antibody is: synthetic peptide directed towards the N-terminal region of Human HNRNPUL1. Synthetic peptide located within the following region: MGFCHVGQAGLELLTSGDPPASASQSAGITGVSHRARPSVFVFLIHYSSF |
HNRNPUL1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human HNRNPUL1 |
Germany
Japan
United Kingdom
China
