HNRPUL1 (HNRNPUL1) Rabbit Polyclonal Antibody

CAT#: TA333898

Rabbit Polyclonal Anti-HNRNPUL1 Antibody

Product Images

Host: Rabbit; Target Name: HNRNPUL1; Sample Tissue: COLO205 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml.

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-HNRNPUL1 Antibody is: synthetic peptide directed towards the N-terminal region of Human HNRNPUL1. Synthetic peptide located within the following region: MGFCHVGQAGLELLTSGDPPASASQSAGITGVSHRARPSVFVFLIHYSSF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 42 kDa
• Gene Name: heterogeneous nuclear ribonucleoprotein U like 1
• Database Link:
  NP_008971
  Entrez Gene 11100 Human
  UniProt ID Q9BUJ2
• Background: This gene encodes a nuclear RNA-binding protein of the heterogeneous nuclear ribonucleoprotein (hnRNP) family. This protein binds specifically to adenovirus E1B-55kDa oncoprotein. It may play an important role in nucleocytoplasmic RNA transport, and its function is modulated by E1B-55kDa in adenovirus-infected cells. Two transcript variants encoding different isoforms have been found for this gene. Additional variants have also been found, but their full-length natures have not been determined.
• Synonyms: E1B-AP5; E1BAP5; HNRPUL1
• Note: Immunogen sequence homology: Human: 100%; Rat: 86%; Mouse: 85%

Reference Data

• Protein Families: Druggable Genome