HOXC9 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human HOXC9 |
HOXC9 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human HOXC9 |
HOXC9 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human HOXC9 |
HOXC9 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human HOXC9 |
Rabbit Polyclonal Anti-HOXC9 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HOXC9 antibody: synthetic peptide directed towards the N terminal of human HOXC9. Synthetic peptide located within the following region: MSATGPISNYYVDSLISHDNEDLLASRFPATGAHPAAARPSGLVPDCSDF |
Rabbit Polyclonal Anti-Hoxc9 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Hoxc9 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Hoxc9. Synthetic peptide located within the following region: EFLFNMYLTRDRRYEVARVLNLTERQVKIWFQNRRMKMKKMNKEKTDKEQ |
Rabbit Polyclonal Anti-HOXC9 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HOXC9 antibody: synthetic peptide directed towards the middle region of human HOXC9. Synthetic peptide located within the following region: DRAPQTLPSPEADALAGSKHKEEKADLDPSNPVANWIHARSTRKKRCPYT |
Rabbit Polyclonal Anti-HOXC9 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HOXC9 antibody: synthetic peptide directed towards the N terminal of human HOXC9. Synthetic peptide located within the following region: MSATGPISNYYVDSLISHDNEDLLASRFPATGAHPAAARPSGLVPDCSDF |
HOXC9 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human HOXC9 |
HOXC9 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human HOXC9 |
HOXC9 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human HOXC9 (NP_008828.1). |
Modifications | Unmodified |