Antibodies

View as table Download

HOXC9 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human HOXC9

HOXC9 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human HOXC9

HOXC9 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human HOXC9

Rabbit Polyclonal Anti-HOXC9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HOXC9 antibody: synthetic peptide directed towards the N terminal of human HOXC9. Synthetic peptide located within the following region: MSATGPISNYYVDSLISHDNEDLLASRFPATGAHPAAARPSGLVPDCSDF

Rabbit Polyclonal Anti-Hoxc9 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Hoxc9 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Hoxc9. Synthetic peptide located within the following region: EFLFNMYLTRDRRYEVARVLNLTERQVKIWFQNRRMKMKKMNKEKTDKEQ

Rabbit Polyclonal Anti-HOXC9 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HOXC9 antibody: synthetic peptide directed towards the middle region of human HOXC9. Synthetic peptide located within the following region: DRAPQTLPSPEADALAGSKHKEEKADLDPSNPVANWIHARSTRKKRCPYT

Rabbit Polyclonal Anti-HOXC9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HOXC9 antibody: synthetic peptide directed towards the N terminal of human HOXC9. Synthetic peptide located within the following region: MSATGPISNYYVDSLISHDNEDLLASRFPATGAHPAAARPSGLVPDCSDF

HOXC9 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human HOXC9

HOXC9 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human HOXC9

HOXC9 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human HOXC9 (NP_008828.1).
Modifications Unmodified