Antibodies

View as table Download

2 Hydroxy phytanoyl CoA lyase (HACL1) (C-term) rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide selected from the C-terminal region of human PHYH2

Rabbit Polyclonal Anti-HACL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HACL1 antibody is: synthetic peptide directed towards the N-terminal region of Human HACL1. Synthetic peptide located within the following region: CWPLLVIGGSSERNQETMGAFQEFPQVEACRLYTKFSARPSSIEAIPFVI

Rabbit Polyclonal Anti-HACL1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human HACL1

HACL1 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human HACL1