USD 450.00
2 Weeks
2 Hydroxy phytanoyl CoA lyase (HACL1) (C-term) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human PHYH2 |
USD 450.00
2 Weeks
2 Hydroxy phytanoyl CoA lyase (HACL1) (C-term) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human PHYH2 |
Rabbit Polyclonal Anti-HACL1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HACL1 antibody is: synthetic peptide directed towards the N-terminal region of Human HACL1. Synthetic peptide located within the following region: CWPLLVIGGSSERNQETMGAFQEFPQVEACRLYTKFSARPSSIEAIPFVI |
Rabbit Polyclonal Anti-HACL1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human HACL1 |
HACL1 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human HACL1 |