2 Hydroxy phytanoyl CoA lyase (HACL1) Rabbit Polyclonal Antibody

CAT#: TA334310

Rabbit Polyclonal Anti-HACL1 Antibody

Product Images

Host: Rabbit; Target Name: HACL1; Sample Tissue: THP-1 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HACL1 antibody is: synthetic peptide directed towards the N-terminal region of Human HACL1. Synthetic peptide located within the following region: CWPLLVIGGSSERNQETMGAFQEFPQVEACRLYTKFSARPSSIEAIPFVI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 64 kDa
• Gene Name: 2-hydroxyacyl-CoA lyase 1
• Database Link:
  NP_036392
  Entrez Gene 26061 Human
  UniProt ID Q9UJ83
• Background: HACL1 catalyzes a carbon-carbon cleavage reaction; It cleaves a 2-hydroxy-3-methylacyl-CoA into formyl-CoA and a 2-methyl-branched fatty aldehyde.
• Synonyms: 2-HPCL; HPCL; HPCL2; PHYH2
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Guinea pig: 100%; Dog: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Horse: 86%; Zebrafish: 79%