2 Hydroxy phytanoyl CoA lyase (HACL1) Rabbit Polyclonal Antibody

CAT#: TA334310

Rabbit Polyclonal Anti-HACL1 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "HACL1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-HACL1 antibody is: synthetic peptide directed towards the N-terminal region of Human HACL1. Synthetic peptide located within the following region: CWPLLVIGGSSERNQETMGAFQEFPQVEACRLYTKFSARPSSIEAIPFVI
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 64 kDa
Gene Name 2-hydroxyacyl-CoA lyase 1
Background HACL1 catalyzes a carbon-carbon cleavage reaction; It cleaves a 2-hydroxy-3-methylacyl-CoA into formyl-CoA and a 2-methyl-branched fatty aldehyde.
Synonyms 2-HPCL; HPCL; HPCL2; PHYH2
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Guinea pig: 100%; Dog: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Horse: 86%; Zebrafish: 79%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.