Antibodies

Jump to Filters
View as table Download
HAPLN2 Rabbit Polyclonal Antibody
TA344718

USD 475.00

5 Days

Rabbit Polyclonal Anti-HAPLN2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HAPLN2 antibody: synthetic peptide directed towards the middle region of human HAPLN2. Synthetic peptide located within the following region: LDQCDGGWLADGSVRFPITTPRPRCGGLPDPGVRSFGFPRPQQAAYGTYC
HAPLN2 Rabbit Polyclonal Antibody
TA306540

USD 430.00

5 Days

Rabbit Polyclonal BRAL1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen BRAL1 antibody was raised against a 12 amino acid peptide from near the center of human BRAL1.
HAPLN2 Rabbit Polyclonal Antibody
TA359647

USD 360.00

5 Days

HAPLN2 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-HAPLN2 antibody is: synthetic peptide directed towards the C-terminal region of Human HPLN2