Rabbit Polyclonal Anti-HBP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HBP1 antibody: synthetic peptide directed towards the N terminal of human HBP1. Synthetic peptide located within the following region: MVWEVKTNQMPNAVQKLLLVMDKRASGMNDSLELLQCNENLPSSPGYNSC |
Rabbit Polyclonal Anti-HBP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HBP1 antibody: synthetic peptide directed towards the middle region of human HBP1. Synthetic peptide located within the following region: SVILGDRWKKMKNEERRMYTLEAKALAEEQKRLNPDCWKRKRTNSGSQQH |
Rabbit Polyclonal Anti-HBP1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HBP1 Antibody: A synthesized peptide derived from human HBP1 |
Rabbit Polyclonal Anti-Phospho-HBP1(Ser402) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Phospho-HBP1(Ser402) Antibody: A synthesized peptide derived from human HBP1 around the phosphorylation site of Sersine 402 |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-HBP1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human HBP1. |
Rabbit Polyclonal Anti-HBP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HBP1 antibody: synthetic peptide directed towards the middle region of human HBP1. Synthetic peptide located within the following region: FSKNCGSPGSSQLSSNSLYAKAVKNHSSGTVSATSPNKCKRPMNAFMLFA |
HBP1 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human HBP1 |
HBP1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 215-514 of human HBP1 (NP_036389.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
