HBP1 Rabbit Polyclonal Antibody

CAT#: TA343693

Rabbit Polyclonal Anti-HBP1 Antibody

Product Images

WB Suggested Anti-HBP1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Hela cell lysate. HBP1 is supported by BioGPS gene expression data to be expressed in HeLa

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HBP1 antibody: synthetic peptide directed towards the middle region of human HBP1. Synthetic peptide located within the following region: SVILGDRWKKMKNEERRMYTLEAKALAEEQKRLNPDCWKRKRTNSGSQQH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 58 kDa
• Gene Name: HMG-box transcription factor 1
• Database Link:
  NP_036389
  Entrez Gene 26959 Human
  UniProt ID O60381
• Background: HBP1 is a transcriptional repressor that binds to the promoter region of target genes. This protein plays a role in the regulation of the cell cycle and of the Wnt pathway. It binds preferentially to the sequence 5'-TTCATTCATTCA-3'. Binding to the H1F0 promoter, HBP1 is enhanced by interaction with RB1. The protein also can disrupt the interaction between DNA and TCF4.
• Synonyms: FLJ16340
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 92%

Reference Data

• Protein Families: Transcription Factors