Antibodies

Jump to Filters
View as table Download
Host cell factor C1 regulator 1 (HCFC1R1) (N-term) Rabbit Polyclonal Antibody
AP52012PU-N

USD 450.00

2 Weeks

Host cell factor C1 regulator 1 (HCFC1R1) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human HCFC1R1.
Host cell factor C1 regulator 1 (HCFC1R1) Rabbit Polyclonal Antibody
TA336194

USD 375.00

5 Days

Rabbit Polyclonal Anti-HCFC1R1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-HCFC1R1 Antibody: synthetic peptide directed towards the middle region of human HCFC1R1. Synthetic peptide located within the following region: LRGAVPMSTKRRLEEEQEPLRKQFLSEENMATHFSQLSLHNDHPYCSPPM