Rabbit Polyclonal Anti-HDHD3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-HDHD3 antibody is: synthetic peptide directed towards the C-terminal region of Human HDHD3. Synthetic peptide located within the following region: AHVGDNYLCDYQGPRAVGMHSFLVVGPQALDPVVRDSVPKEHILPSLAHL |
Carrier-free (BSA/glycerol-free) HDHD3 mouse monoclonal antibody,clone OTI2A8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
HDHD3 mouse monoclonal antibody,clone OTI2A8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
HDHD3 mouse monoclonal antibody,clone OTI2A8, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
HDHD3 mouse monoclonal antibody,clone OTI2A8, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
HDHD3 mouse monoclonal antibody,clone OTI2A8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
Germany
Japan
United Kingdom
China
