HDHD3 Rabbit Polyclonal Antibody

CAT#: TA337338

Rabbit Polyclonal Anti-HDHD3 Antibody

Product Images

Host: Rabbit; Target Name: HDHD3; Sample Tissue: MCF7 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-HDHD3 antibody is: synthetic peptide directed towards the C-terminal region of Human HDHD3. Synthetic peptide located within the following region: AHVGDNYLCDYQGPRAVGMHSFLVVGPQALDPVVRDSVPKEHILPSLAHL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 27 kDa
• Gene Name: haloacid dehalogenase like hydrolase domain containing 3
• Database Link:
  NP_112496
  Entrez Gene 81932 Human
  UniProt ID Q9BSH5
• Background: The function of this protein remains unknown.
• Synonyms: 2810435D12Rik; C9orf158
• Note: Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Rat: 93%; Rabbit: 93%; Horse: 86%; Pig: 79%; Bovine: 79%; Guinea pig: 79%