Rabbit Polyclonal Anti-HENMT1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-HENMT1 antibody is: synthetic peptide directed towards the N-terminal region of Human HENMT1. Synthetic peptide located within the following region: RETAIQFKPPLYRQRYQFVKNLVDQHEPKKVADLGCGDTSLLRLLKVNPC |
Rabbit Polyclonal Anti-HENMT1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-HENMT1 antibody is: synthetic peptide directed towards the C-terminal region of Human HENMT1. Synthetic peptide located within the following region: QVESLRVSHLPRRKEQAGERGDKPKDIGGSKAPVPCFGPVFTEVEKAKIE |
HENMT1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human HENMT1 |
Germany
Japan
United Kingdom
China
