Rabbit polyclonal anti-HES6 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human HES6. |
Rabbit polyclonal anti-HES6 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human HES6. |
HES6 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Rabbit Polyclonal Anti-Hes6 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Hes6 Antibody is: synthetic peptide directed towards the middle region of Mouse Hes6. Synthetic peptide located within the following region: LLAGTEVQAKLENAEVLELTVRRVQGALRGRAREREQLQAEASERFAAGY |
Rabbit Polyclonal Anti-HES6 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-HES6 Antibody: synthetic peptide directed towards the C terminal of human HES6. Synthetic peptide located within the following region: PPGPGDDLCSDLEEAPEAELSQAPAEGPDLVPAALGSLTTAQIARSVWRP |
HES6 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 13~42 amino acids from the N-terminal region of human HES6 |
Carrier-free (BSA/glycerol-free) HES6 mouse monoclonal antibody,clone OTI1D6
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HES6 mouse monoclonal antibody,clone OTI1H2
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HES6 mouse monoclonal antibody,clone OTI3H10
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HES6 mouse monoclonal antibody,clone OTI2F7
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HES6 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-224 of human HES6 (NP_061115.2). |
Modifications | Unmodified |
HES6 mouse monoclonal antibody,clone OTI1D6
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HES6 mouse monoclonal antibody,clone 1D6, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
HES6 mouse monoclonal antibody,clone 1D6, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
HES6 mouse monoclonal antibody,clone OTI1D6
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HES6 mouse monoclonal antibody,clone OTI1H2
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HES6 mouse monoclonal antibody,clone 1H2, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
HES6 mouse monoclonal antibody,clone 1H2, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
HES6 mouse monoclonal antibody,clone OTI1H2
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HES6 mouse monoclonal antibody,clone OTI3H10
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
HES6 mouse monoclonal antibody,clone OTI3H10, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
HES6 mouse monoclonal antibody,clone OTI3H10, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
HES6 mouse monoclonal antibody,clone OTI3H10
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HES6 mouse monoclonal antibody,clone OTI2F7
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HES6 mouse monoclonal antibody,clone 2F7, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
HES6 mouse monoclonal antibody,clone 2F7, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
HES6 mouse monoclonal antibody,clone OTI2F7
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |