Antibodies

Jump to Filters
View as table Download
HGFAC Rabbit Polyclonal Antibody
TA346291

USD 475.00

5 Days

Rabbit Polyclonal Anti-HGFAC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-HGFAC antibody is: synthetic peptide directed towards the C-terminal region of Human HGFAC. Synthetic peptide located within the following region: SSLREALVPLVADHKCSSPEVYGADISPNMLCAGYFDCKSDACQGDSGGP
HGFAC Rabbit Polyclonal Antibody
TA377011

USD 220.00

3 Weeks

HGFAC Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 408-655 of human HGFAC (NP_001519.1).
Modifications Unmodified