HGFAC Rabbit Polyclonal Antibody

CAT#: TA346291

Rabbit Polyclonal Anti-HGFAC Antibody

Product Images

Host: Rabbit; Target Name: HGFAC; Sample Tissue: THP-1 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-HGFAC antibody is: synthetic peptide directed towards the C-terminal region of Human HGFAC. Synthetic peptide located within the following region: SSLREALVPLVADHKCSSPEVYGADISPNMLCAGYFDCKSDACQGDSGGP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 72 kDa
• Gene Name: HGF activator
• Database Link:
  NP_001284368
  Entrez Gene 3083 Human
  UniProt ID Q04756
• Background: The function of this protein remains unknown.
• Synonyms: HGFA
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, Protease, Secreted Protein, Transmembrane