Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-HIC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HIC1 antibody: synthetic peptide directed towards the N terminal of human HIC1. Synthetic peptide located within the following region: ALCASERRCSPLCGLDLSKKSPPGSAAPERPLAERELPPRPDSPPSAGPA |
Rabbit Polyclonal Anti-HIC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HIC1 antibody: synthetic peptide directed towards the N terminal of human HIC1. Synthetic peptide located within the following region: RRCSPLCGLDLSKKSPPGSAAPERPLAERELPPRPDSPPSAGPAAYKEPP |
Rabbit Polyclonal Anti-HIC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HIC1 antibody: synthetic peptide directed towards the middle region of human HIC1. Synthetic peptide located within the following region: GETPIAVMGEFANLATSLNPLDPDKDEEEEEEEESEDELPQDISLAAGGE |
HIC1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 180-430 of human HIC1 (NP_001091672.1). |
| Modifications | Unmodified |
HIC1 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 180-430 of human HIC1 (NP_001091672.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- HIC1