HIC1 Rabbit Polyclonal Antibody

CAT#: TA343615

Rabbit Polyclonal Anti-HIC1 Antibody

Product Images

WB Suggested Anti-HIC1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: 721_B cell lysate.HIC1 is supported by BioGPS gene expression data to be expressed in 721_B

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HIC1 antibody: synthetic peptide directed towards the middle region of human HIC1. Synthetic peptide located within the following region: GETPIAVMGEFANLATSLNPLDPDKDEEEEEEEESEDELPQDISLAAGGE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 74 kDa
• Gene Name: hypermethylated in cancer 1
• Database Link:
  NP_006488
  Entrez Gene 3090 Human
  UniProt ID Q14526
• Background: HIC1 is a transcriptional repressor. HIC1 may act as a tumor suppressor. HIC1 may be involved in development of head, face, limbs and ventral body wall. Defects in HIC1 may be a cause of the facial dysmorphism and additional birth defects (except for lissencephaly) seen in the contiguous gene disorder Miller-Dieker syndrome (MDS), like defective development of the nose, jaws, extremities, gastrointestinal tract, and kidney.
• Synonyms: hic-1; ZBTB29; ZNF901
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Rat: 93%; Mouse: 93%