Rabbit Polyclonal antibody to Homer (homer homolog 1 (Drosophila))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 72 and 339 of Homer (Uniprot ID#Q86YM7) |
Rabbit Polyclonal Anti-HOMER1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HOMER1 antibody: synthetic peptide directed towards the N terminal of human HOMER1. Synthetic peptide located within the following region: EKFQEFKEAARLAKEKSQEKMELTSTPSQESAGGDLQSPLTPESINGTDD |
Rabbit Polyclonal Anti-HOMER1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HOMER1 antibody: synthetic peptide directed towards the C terminal of human HOMER1. Synthetic peptide located within the following region: QEQRDSLTQKLQEVEIRNKDLEGQLSDLEQRLEKSQNEQEAFRNNLKTLL |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Germany
Japan
United Kingdom
China
