Rabbit Polyclonal Anti-HS1BP3 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HS1BP3 antibody: synthetic peptide directed towards the N terminal of human HS1BP3. Synthetic peptide located within the following region: YSEIEEFYQKLSSRYAAASLPPLPRKVLFVGESDIRERRAVFNEILRCVS |
Carrier-free (BSA/glycerol-free) HS1BP3 mouse monoclonal antibody,clone OTI6C6
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
HS1BP3 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human HS1BP3 |
HS1BP3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human HS1BP3 (NP_071905.3). |
| Modifications | Unmodified |
HS1BP3 mouse monoclonal antibody,clone OTI6C6
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
HS1BP3 mouse monoclonal antibody,clone OTI6C6, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
HS1BP3 mouse monoclonal antibody,clone OTI6C6, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
HS1BP3 mouse monoclonal antibody,clone OTI6C6
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
Germany
Japan
United Kingdom
China
