HS1BP3 Rabbit Polyclonal Antibody

CAT#: TA344680

Rabbit Polyclonal Anti-HS1BP3 Antibody - N-terminal region

Product Images

WB Suggested Anti-HS1BP3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Human brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HS1BP3 antibody: synthetic peptide directed towards the N terminal of human HS1BP3. Synthetic peptide located within the following region: YSEIEEFYQKLSSRYAAASLPPLPRKVLFVGESDIRERRAVFNEILRCVS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 43 kDa
• Gene Name: HCLS1 binding protein 3
• Database Link:
  NP_071905
  Entrez Gene 64342 Human
  UniProt ID Q53T59
• Background: The protein encoded by this gene shares similarity with mouse Hs1bp3, an Hcls1/Hs1-interacting protein that may be involved in lymphocyte activation.
• Synonyms: ETM2; HS1-BP3
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%