Rabbit Polyclonal Anti-HSD17B6 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSD17B6 antibody: synthetic peptide directed towards the N terminal of human HSD17B6. Synthetic peptide located within the following region: MWLYLAAFVGLYYLLHWYRERQVVSHLQDKYVFITGCDSGFGNLLARQLD |
Rabbit Polyclonal Anti-HSD17B6 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human HSD17B6 |
HSD17B6 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human HSD17B6 |
HSD17B6 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 178-317 of human HSD17B6 (NP_003716.2). |
| Modifications | Unmodified |
HSD17B6 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 178-317 of human HSD17B6 (NP_003716.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
