Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-HSF2BP Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSF2BP antibody: synthetic peptide directed towards the N terminal of human HSF2BP. Synthetic peptide located within the following region: RHMGTKEEFVKVRKKDLERLTTEVMQIRDFLPRILNGEVLESFQKLKIVE |
Rabbit Polyclonal Anti-HSF2BP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSF2BP antibody: synthetic peptide directed towards the N terminal of human HSF2BP. Synthetic peptide located within the following region: EQLKMDCEHFKARLETVQADNIREKKEKLALRQQLNEAKQQLLQQAEYCT |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) HSF2BP mouse monoclonal antibody,clone OTI2A1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HSF2BP rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human HSF2BP |
USD 379.00
In Stock
HSF2BP mouse monoclonal antibody,clone OTI2A1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
HSF2BP mouse monoclonal antibody,clone OTI2A1, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
HSF2BP mouse monoclonal antibody,clone OTI2A1, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
USD 159.00
2 Days
HSF2BP mouse monoclonal antibody,clone OTI2A1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- HSF2BP