Germany
Japan
United Kingdom
China
Rabbit anti-HTR2B Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human HTR2B |
Antibodies
View as table Download
Rabbit Polyclonal anti-HTR2B antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HTR2B antibody: synthetic peptide directed towards the N terminal of human HTR2B. Synthetic peptide located within the following region: QTESIPEEMKQIVEEQGNKLHWAALLILMVIIPTIGGNTLVILAVSLEKK |
Rabbit Polyclonal Anti-HTR2B Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | HTR1B / 5-HT2B Receptor antibody was raised against synthetic 20 amino acid peptide from N-terminal extracellular domain of human 5HT2B Receptor. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Monkey (100%); Marmoset, Bat (95%); Horse (90%); Dog, Panda (85%); Bovine, Rabbit (80%). |
Rabbit Polyclonal Anti-HTR2B Antibody (Extracellular Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | HTR1B / 5-HT2B Receptor antibody was raised against synthetic 15 amino acid peptide from 2nd extracellular domain of human 5HT2B Receptor. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Marmoset (100%); Bovine, Bat (93%); Mouse, Hamster, Panda, Horse, Rabbit, Pig (80%). |
Anti-HTR2B Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 1-58 amino acids of human 5-hydroxytryptamine receptor 2B |
HTR2B Antibody - C-terminal region
| Applications | WB |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of mouse HTR2B |
HTR2B Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 233-330 of human HTR2B (NP_000858.3). |
| Modifications | Unmodified |
Active filters
Target Symbol
- HTR2B