Germany
Japan
United Kingdom
China
Antibodies
View as table Download
5HT4 Receptor (HTR4) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of Human Serotonin receptor 4 (HTR4). |
Rabbit Polyclonal Anti-HTR4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HTR4 antibody: synthetic peptide directed towards the middle region of human HTR4. Synthetic peptide located within the following region: GCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSNSTYCVFMVNKPYA |
Rabbit Polyclonal Anti-HTR4 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | HTR4 / 5-HT4 Receptor antibody was raised against synthetic 17 amino acid peptide from C-terminus of human 5HT4 Receptor. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Hamster, Panda, Dog, Bat, Bovine, Horse, Rabbit, Guinea pig (100%); Marmoset, Elephant, Opossum, Turkey, Chicken, Platypus, Lizard (94%); Mouse, Rat (88%); Pig (82%). |
Rabbit Polyclonal Anti-HTR4 Antibody (Cytoplasmic Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | HTR4 / 5-HT4 Receptor antibody was raised against synthetic 15 amino acid peptide from 3rd cytoplasmic domain of human 5HT4 Receptor. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Elephant, Panda, Dog, Bat, Bovine, Rabbit, Horse, Pig (100%); Mouse, Rat, Hamster (93%); Guinea pig, Platypus (87%); Lizard (80%). |
Rabbit Polyclonal Anti-HTR4 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | HTR4 / 5-HT4 Receptor antibody was raised against synthetic 20 amino acid peptide from C-terminus of human 5HT4 Receptor. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Elephant, Horse, Pig (100%); Panda, Dog, Rabbit (95%); Bat, Bovine (90%); Guinea pig (85%); Mouse, Rat (80%). |
Rabbit Polyclonal Anti-HTR4 Antibody (Cytoplasmic Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | HTR4 / 5-HT4 Receptor antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human 5HT4 Receptor. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Mouse, Rat (94%); Marmoset, Hamster, Elephant, Panda, Dog, Horse, Pig, Guinea pig (88%); Bat, Rabbit (81%). |
Anti-5HT4 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 45-59 amino acids of Human 5-hydroxytryptamine (serotonin) receptor 4, G protein-coupled |
HTR4 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human HTR4. |
| Modifications | Unmodified |
Active filters
Target Symbol
- HTR4