Antibodies

Jump to Filters
View as table Download
ORP150 (HYOU1) (C-term) Rabbit Polyclonal Antibody
AP22660PU-N

USD 440.00

2 Weeks

ORP150 (HYOU1) (C-term) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human, Rat
Immunogen HYOU1 antibody was raised against synthetic peptide
ORP150 (HYOU1) Rabbit Polyclonal Antibody
TA339043

USD 375.00

5 Days

Rabbit Polyclonal Anti-HYOU1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HYOU1 antibody: synthetic peptide directed towards the middle region of human HYOU1. Synthetic peptide located within the following region: DREVQYLLNKAKFTKPRPRPKDKNGTRAEPPLNASASDQGEKVIPPAGQT
ORP150 (HYOU1) Rabbit Polyclonal Antibody
TA354517

USD 350.00

5 Days

Rabbit anti HYOU1 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide next to the C-terminus of HYOU1 protein. This sequence is identical to rat, mouse, human and dog, bovine and horse origins.
ORP150 (HYOU1) Rabbit Polyclonal Antibody
TA377300

USD 220.00

3 Weeks

ORP150/GRP170/HSP12A Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human ORP150/GRP170/HSP12A (NP_001124463.1).
Modifications Unmodified