Antibodies

Jump to Filters
View as table Download
IGFL2 Rabbit Polyclonal Antibody
TA332341

USD 375.00

5 Days

Rabbit Polyclonal Anti-IGFL2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-IGFL2 Antibody is: synthetic peptide directed towards the C-terminal region of Human IGFL2. Synthetic peptide located within the following region: QCGPPCTFWPCFELCCLDSFGLTNDFVVKLKVQGVNSQCHSSPISSKCES