IGFL2 Rabbit Polyclonal Antibody

CAT#: TA332341

Rabbit Polyclonal Anti-IGFL2 Antibody

Product Images

Host: Rabbit; Target Name: IGFL2; Sample Tissue: Jurkat Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-IGFL2 Antibody is: synthetic peptide directed towards the C-terminal region of Human IGFL2. Synthetic peptide located within the following region: QCGPPCTFWPCFELCCLDSFGLTNDFVVKLKVQGVNSQCHSSPISSKCES
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 14 kDa
• Gene Name: IGF like family member 2
• Database Link:
  NP_001002915
  Entrez Gene 147920 Human
  UniProt ID Q6UWQ7
• Background: IGFL2 belongs to the insulin-like growth factor family of signaling molecules that play critical roles in cellular energy metabolism and in growth and development, especially prenatal growth.
• Synonyms: UNQ645; VPRI645
• Note: Immunogen sequence homology: Human: 100%; Rabbit: 92%

Reference Data

• Protein Families: Secreted Protein