Rabbit Polyclonal Anti-IMPAD1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IMPAD1 antibody: synthetic peptide directed towards the middle region of human IMPAD1. Synthetic peptide located within the following region: TAWAMVDGGSNVKARSSYNEKTPRIVVSRSHSGMVKQVALQTFGNQTTII |
Rabbit Polyclonal Anti-IMPAD1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IMPAD1 antibody: synthetic peptide directed towards the N terminal of human IMPAD1. Synthetic peptide located within the following region: VLAAVRGGDEVRRVRESNVLHEKSKGKTREGAEDKMTSGDVLSNRKMFYL |
Rabbit Polyclonal Anti-IMPAD1 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human IMPAD1 |
IMPAD1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human IMPAD1 |
Germany
Japan
United Kingdom
China