IMPAD1 Rabbit Polyclonal Antibody

CAT#: TA342036

Rabbit Polyclonal Anti-IMPAD1 Antibody

Product Images

WB Suggested Anti-IMPAD1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Human Spleen

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-IMPAD1 antibody: synthetic peptide directed towards the middle region of human IMPAD1. Synthetic peptide located within the following region: TAWAMVDGGSNVKARSSYNEKTPRIVVSRSHSGMVKQVALQTFGNQTTII
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 39 kDa
• Gene Name: inositol monophosphatase domain containing 1
• Database Link:
  NP_060283
  Entrez Gene 54928 Human
  UniProt ID Q9NX62
• Background: This gene encodes a member ofThe inositol monophosphatase family.The encoded protein is localized toThe Golgi apparatus and catalyzesThe hydrolysis of phosphoadenosine phosphate (PAP) to adenosine monophosphate (AMP). Mutations inThis gene are a cause of GRAPP type chondrodysplasia with joint dislocations, and a pseudogene ofThis gene is located onThe long arm of chromosome 1. [provided by RefSeq, Dec 2011]
• Synonyms: GPAPP; IMP-3; IMP 3; IMPA3
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Transmembrane