Rabbit Polyclonal Anti-INSIG1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-INSIG1 antibody: synthetic peptide directed towards the middle region of human INSIG1. Synthetic peptide located within the following region: ITIAFLATLITQFLVYNGVYQYTSPDFLYIRSWLPCIFFSGGVTVGNIGR |
Rabbit Polyclonal Anti-INSIG1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-INSIG1 antibody: synthetic peptide directed towards the middle region of human INSIG1. Synthetic peptide located within the following region: TTWLFHKTRSNYRVFLKSPIVIESSKPPILRARKILEENLTVDYDKDYLF |
Rabbit Polyclonal Anti-INSIG1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-INSIG1 antibody: synthetic peptide directed towards the middle region of human INSIG1. Synthetic peptide located within the following region: TTWLFHKTRSNYRVFLKSPIVIESSKPPILRARKILEENLTVDYDKDYLF |
Rabbit polyclonal anti-Insig1 antibody
| Applications | WB |
| Reactivities | Bovine, Hamster, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 248 of rat Insig1 |
INSIG1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human INSIG1 |
INSIG1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human INSIG1 (NP_005533.2). |
Germany
Japan
United Kingdom
China
