INTS1 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of Human INTS1 |
INTS1 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of Human INTS1 |
Rabbit Polyclonal Anti-INTS1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-INTS1 Antibody is: synthetic peptide directed towards the N-terminal region of Human INTS1. Synthetic peptide located within the following region: TVRRPSAAAKPSGHPPPGDFIALGSKGQANESKTASTLLKPAPSGLPSER |
Rabbit Polyclonal Anti-INTS1 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human INTS1 |