INTS1 Rabbit Polyclonal Antibody

CAT#: TA332219

Rabbit Polyclonal Anti-INTS1 Antibody

Product Images

Host: Rabbit; Target Name: INTS1; Sample Tissue: Fetal Liver lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-INTS1 Antibody is: synthetic peptide directed towards the N-terminal region of Human INTS1. Synthetic peptide located within the following region: TVRRPSAAAKPSGHPPPGDFIALGSKGQANESKTASTLLKPAPSGLPSER
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 240 kDa
• Gene Name: integrator complex subunit 1
• Database Link:
  NP_001073922
  Entrez Gene 26173 Human
  UniProt ID Q8N201
• Background: INTS1 is a subunit of the Integrator complex, which associates with the C-terminal domain of RNA polymerase II large subunit and mediates 3-prime end processing of small nuclear RNAs U1 and U2 .
• Synonyms: INT1; NET28
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Guinea pig: 100%; Horse: 86%; Mouse: 86%; Bovine: 86%