Antibodies

Jump to Filters
View as table Download
IFI30 Rabbit Polyclonal Antibody
TA307992

USD 415.00

5 Days

Rabbit polyclonal antibody to GILT (interferon, gamma-inducible protein 30)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 14 and 250 of GILT (Uniprot ID#P13284)
IFI30 Rabbit Polyclonal Antibody
TA338132

USD 375.00

5 Days

Rabbit Polyclonal Anti-IFI30 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IFI30 antibody is: synthetic peptide directed towards the middle region of Human IFI30. Synthetic peptide located within the following region: YGNAQEQNVSGRWEFKCQHGEEECKFNKVEACVLDELDMELAFLTIVCME
IFI30 Rabbit Polyclonal Antibody
TA377333

USD 220.00

3 Weeks

IFI30 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human IFI30 (NP_006323.2).
Modifications Unmodified